PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1084501g005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MYB
Protein Properties Length: 231aa    MW: 26682.8 Da    PI: 5.6823
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1084501g005genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.6e-171764148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT++Ede+l++ v+q+G g+W+ +++  g++R +k+c++rw +yl
  PDK_30s1084501g005 17 KGPWTAQEDEILIEHVNQHGEGRWNCVSKLTGLRRNGKSCRLRWVNYL 64
                        79********************************************97 PP

2Myb_DNA-binding53.17.3e-1770114147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+ T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
  PDK_30s1084501g005  70 RGKITPHEENIILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 114
                         8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7711264IPR017930Myb domain
SuperFamilySSF466898.07E-3014111IPR009057Homeodomain-like
SMARTSM007175.3E-141666IPR001005SANT/Myb domain
PfamPF002493.0E-151764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-221871IPR009057Homeodomain-like
CDDcd001671.15E-91964No hitNo description
PROSITE profilePS5129424.97965119IPR017930Myb domain
SMARTSM007177.8E-1669117IPR001005SANT/Myb domain
PfamPF002492.9E-1470114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2472118IPR009057Homeodomain-like
CDDcd001674.96E-1074115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MEGQLMSWGT LENGWRKGPW TAQEDEILIE HVNQHGEGRW NCVSKLTGLR RNGKSCRLRW  60
VNYLRPDLKR GKITPHEENI ILELHALWGN RWSTIARSLP GRTDNEIKNY WRTHFKKSKP  120
SKNIEKARAR FLRQQQEQQE REEEQQQADM RGIMTQVEEA ALAQDMQEMA YMYPLNYMLQ  180
GGEGGGGGSI SDGSSEEEAW GSLWNLDDVH DDGEGVCRGG LTMQDQVLTF Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-26171177106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008783782.11e-172PREDICTED: myb-related protein 340-like
TrEMBLM0RWQ31e-112M0RWQ3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P03450_0011e-112(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.14e-67myb domain protein 79